Peptide Shop
Research Use Only Not for human or veterinary use

Certificate of Analysis

Doc No.: CoA-LL37-0682 Rev.: 1.0 Issued: 2026-03-06

Product Identification

LL-37, human cathelicidin

Catalog No.
PEPTIDE-LL-37
CAS No.
154947-66-7
Chemical Name
LL-37, human cathelicidin
Net Content per Vial
1 × 1 mg vial
Package Configuration
1 × 1 mg vial
Batch / Lot No.
PS-2604-0682
Manufacture Date
2026-03-01
Retest Date
2029-03-01
Country of Origin
European Union

Physical and Chemical Properties

Molecular Weight
4493.33 g/mol
Appearance
White to off-white lyophilized solid
Solubility
Bacteriostatic water · 0.9 % NaCl
Storage Conditions
Lyophilized: −20 °C / 36 months · 4 °C / 24 months · 15 °C / 3 months
Reconstituted: −80 °C / 6 months · −20 °C / 1 month · 4 °C / 1 week
Amino Acid Sequence
[LL-37, 37 aa]

Analytical Data

Test Parameter Method Specification Result Status
Appearance Visual inspection White to off-white lyophilized solid White to off-white lyophilized solid Pass
Identity (Mass) ESI-MS [M+H]⁺ = 4494.3 ± 0.5 4494.4 Pass
Purity (HPLC) RP-HPLC, UV 220 nm ≥ 98.0 % 98.32 % Pass
Single Impurity (max.) RP-HPLC, UV 220 nm ≤ 0.50 % 0.37 % Pass
Amino Acid Composition Acid hydrolysis / AAA Conforms to theoretical ratios Conforms Pass
Acetate Content Ion chromatography ≤ 12.0 % 7.7 % Pass
TFA Content RP-HPLC, UV 220 nm ≤ 0.50 % < 0.10 % Pass
Water Content Karl Fischer ≤ 6.0 % 3.5 % Pass
Net Peptide Content Calculated (HPLC × AAA × H₂O × counter-ion) ≥ 80.0 % 82.6 % Pass
Bacterial Endotoxins LAL, gel-clot · USP <85> < 5 EU/mg < 0.5 EU/mg Pass
Bioburden USP <61> < 100 CFU/g < 10 CFU/g Pass

Conclusion

Lot PS-2604-0682 has been tested using validated analytical methods and complies with all listed specifications. This batch is released for research distribution.
Caution: This product is supplied for laboratory research use only. It has not been evaluated by any regulatory authority for safety or efficacy in humans or animals. Not for diagnostic, therapeutic, food, or cosmetic use. Handle in accordance with good laboratory practice.
Quality Control Analyst
T. Beneš
Tomáš Beneš, MSc
Date: 2026-03-01
Quality Assurance Approver
A. Ribeiro
Dr. Ana Ribeiro
Date: 2026-03-06
Download PDF